SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005394 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005394
Domain Number 1 Region: 49-276,305-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-41
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005394   Gene: ENSSSCG00000005016   Transcript: ENSSSCT00000005532
Sequence length 463
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:200362036:200410366:-1 gene:ENSSSCG00000005016 transcript:ENSSSCT00000005532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLGSVYGRARGAFSGGFLAAGAPAPGNLWLLCQGGRRASTSSFDVVIIGGGIVG
LASARALILRHPALSIGVLEKEKDLAIHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALI
YEYCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCR
GLMAIDCPYTGIVDYRQVALSFAQDFQEAGGSVLTSFEVEDIEMAKESPSRHKDGMKYPI
VIRNTKGEEVRCQYVVTCAGLYSDRISELSGCNPNPRIVPFRGDYLLLKPEKRYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSARDIMDIILKSGLMKL
VFQNFSYGVNEMYKACFLSATVKHLQKFIPEITISDILRGPAGVRAQALDRDGNLIEDFV
FDGGVGDIGNRILHVRNAPSPAATSSLAISGMIADEVQQRFKL
Download sequence
Identical sequences ENSSSCP00000005394 XP_001926853.1.46622 9823.ENSSSCP00000005394 ENSSSCP00000005394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]