SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005491 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005491
Domain Number 1 Region: 196-208,250-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-62
Family Nuclear receptor ligand-binding domain 0.00000000223
Further Details:      
 
Domain Number 2 Region: 144-222
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005491   Gene: ENSSSCG00000005109   Transcript: ENSSSCT00000005632
Sequence length 526
Comment pep:known chromosome:Sscrofa10.2:1:215715909:215788512:1 gene:ENSSSCG00000005109 transcript:ENSSSCT00000005632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSNLNSPVSYNCSQSVLPLEPGPIYIPSSYVESCHEYSAMTFYSPAVVNYSISS
NSEVGPGRQATSPNVLWPTPGHLSPLAIHCQPSLLYAEPQKSPWCDTRSLEHTLPVNRET
LKRKASGSSCASPVTSPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDY
ICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRKQRNSEGHLHCLS
RAKKNGDHTTRVKELLLSTLSPEQLVLTLLEAEPPHVLVSRPSTPFTEASMMMSLTKLAD
KELVHMISWAKKIPGFVELSLYDQVRLLESCWLEVLMVGLMWRSIDHPGKLIFAPDLVLD
RDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPSAAAQEAESSR
KLTHLLNAVTDALVWVIARSGISSQQQSVRLANLLMLLSHVRHASNKGMEHLLNMKCKNV
VPVYDLLLEMLNAHTLRGNKSLVTGSERSRMEESESKEGPQKPQVQ
Download sequence
Identical sequences F1SRR6
ENSSSCP00000005491 9823.ENSSSCP00000005491 XP_020936953.1.46622 XP_020937009.1.46622 XP_020937051.1.46622 ENSSSCP00000005491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]