SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005874 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005874
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily Histone-fold 4.57e-34
Family TBP-associated factors, TAFs 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005874   Gene: ENSSSCG00000005478   Transcript: ENSSSCT00000006024
Sequence length 147
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:284828751:284831550:-1 gene:ENSSSCG00000005478 transcript:ENSSSCT00000006024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERPEDLNLPNAVITRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD
KSRDEDNDEDEERLEEEEQNEEEDVDN
Download sequence
Identical sequences F1SN88
ENSSSCP00000005874 9823.ENSSSCP00000005874 ENSSSCP00000005874 XP_003122132.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]