SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005982 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005982
Domain Number 1 Region: 257-323
Classification Level Classification E-value
Superfamily Homeodomain-like 3.12e-20
Family Homeodomain 0.0023
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000196
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 47-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000268
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005982
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005982   Gene: ENSSSCG00000005586   Transcript: ENSSSCT00000006141
Sequence length 406
Comment pep:known chromosome:Sscrofa10.2:1:298708067:298728219:-1 gene:ENSSSCG00000005586 transcript:ENSSSCT00000006141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTEAALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF
Download sequence
Identical sequences A0A077ESX4 A0A1S3AT70 A0A212CY49 C4TJC6 E1BM14
9913.ENSBTAP00000014582 NP_001163990.1.46622 NP_001178104.1.59421 NP_001178104.1.76553 NP_001301224.1.57651 XP_005893127.1.15283 XP_006072262.1.26621 XP_007540031.1.11023 XP_008153494.1.99482 XP_012011850.1.54773 XP_017521666.1.32401 XP_019584086.1.88060 ENSSSCP00000005982 ENSSSCP00000005982 ENSBTAP00000014582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]