SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006004 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000006004
Domain Number - Region: 14-24
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006004   Gene: ENSSSCG00000005605   Transcript: ENSSSCT00000006163
Sequence length 125
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:300757551:300805815:-1 gene:ENSSSCG00000005605 transcript:ENSSSCT00000006163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSCFCVRRSRDPPPPQPPPPPPPQRGTERSTMPEVKDLSEALPETSMDPITGVGVVASR
NRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENVSLGVAFRLLSEHSS
LTLLF
Download sequence
Identical sequences ENSSSCP00000006004 ENSSSCP00000006004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]