SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006149 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006149
Domain Number 1 Region: 481-820
Classification Level Classification E-value
Superfamily Folate-binding domain 3.92e-89
Family Aminomethyltransferase folate-binding domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 68-288,388-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.72e-56
Family FAD-linked reductases, N-terminal domain 0.000074
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.41e-28
Family L-aminoacid/polyamine oxidase 0.009
Further Details:      
 
Domain Number 4 Region: 822-916
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000116
Family Aminomethyltransferase beta-barrel domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006149   Gene: ENSSSCG00000005740   Transcript: ENSSSCT00000006311
Sequence length 918
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:307202692:307268119:-1 gene:ENSSSCG00000005740 transcript:ENSSSCT00000006311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRLAATCPHRNPAQGLGPRPRTGGTGPTTEKSVPYQRTLKEAQQPSAEAQGLS
QPLPRAASVVVIGGGSLGCQTLYHLAKLGVSGALLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRDLEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKALYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLSRAATARGAQVIENCPVTGI
RVRTDDFGVRRVAAVETAHGSIQTPCVVNCAGVWAGAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPVFWEEVSDKFAFGLFDLDWDVFGQH
IEGAIHRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIVHGRPEKDMHGYDIRRFHHSLTDHSRWIRERSHESYAKNYSIVFPHDEPLAG
RNMRRDPLHEELLARGCVFQERHGWERPGWFSPQGPAPVLPYDYYGAYGKRAHQDYAYSR
LLGDEYTFDFPPHHDVIKKECLACRGAAAVFDMSYFGKFYLVGPDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSPQASPLTPAFEGDGYYLAVGGAVAQHNWCHL
TTVLQDRQFRCQLVDRSEDLGLISIQGPASRAILQEVLDADLSNEAFPFSTHKLVRAAGH
LVRAIRLSFVGELGWELHIPRPSCLPVYRAVMTAGAKHGLVNAGYRAVDSLSTEKGYRHW
HADLRPDDSPLEAGLAFTCKLKSAVPFLGREALEKQQAEGLRRRLVCFTVDEKVPLFGLE
AIWRSGQVVGHVRRADFGFAIDKTLAYGYIRDPSGRPVSWDFVKSGDYALERMGVAYPAQ
AHLKSPFDPGNRRVKGIY
Download sequence
Identical sequences A0A287BL22
ENSSSCP00000006149 ENSSSCP00000006149 NP_001240851.1.46622 XP_013842530.1.46622 XP_020946499.1.46622 XP_020946542.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]