SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006195 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006195
Domain Number 1 Region: 400-682
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.11e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000132
Further Details:      
 
Domain Number 2 Region: 223-397
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.27e-46
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0004
Further Details:      
 
Domain Number 3 Region: 684-791
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.19e-26
Family Anticodon-binding domain of Class II aaRS 0.0015
Further Details:      
 
Domain Number 4 Region: 161-222
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000632
Family TGS domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006195   Gene: ENSSSCG00000005781   Transcript: ENSSSCT00000006357
Sequence length 801
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:311022067:311077835:1 gene:ENSSSCG00000005781 transcript:ENSSSCT00000006357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLERQEEDIRWLWAEVHRLRDEQLNAPDRCQAEGPCLTREVAQLRAE
NRELRHRLYHLRLCLAEELSHRARQESPAREEARRAAAGAQPPSSQSQEKDTEKKESEPN
SEVKNQPNFVKERLKLFEILKKDHQLLLAIYEKKGNTSNVITVRVADGKTVEGEVWKTTP
YQVAAEISQELAESAVIAKVNGELWDLDRPLEGDSTLELLTFDNEEAQAVYWHSSAHVLG
EAMELHFGGHLCCSTPTDEGFYCDMFTEDRAVSSTELPALQSTCEAIIKEQQPFERLEVS
KEVLLDMFKYNKFKCRILNEKIKTPTTTVYRCGPLVDLCKGPHVRHTGKTNAIKIFKSAS
TYWEDNPEMETLQRVYGISFPDDQMMTDWEKLQEEAKTRDHRKIGKEQELFFFHDLSPGS
CFFLPRGAFIYNALMDFIREEYHQRSFTEVLSPNMYSSKLWEASGHWQHYRENMFTFDVD
KDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSETLSSLTHVRRFQQDD
AHIFCTVEQIEEEIKGCLKFLQSVYSTFGFSFQLNLSTRPEDFLGEVAIWDEAEKQLQNS
LVEFGKPWKMKPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKEGDD
KKNPVIIHRAILGSVERMIAILSENYEGKWPFWLSPRQVIVIPVGPACEKYALQVSNEFL
EEGFMADVDLDHSCTLNKKIQNAQLAQYNFILVVGEKEKANNAVSVQTRDNKIHGEISVT
SAIDKLKKLKKTRTLYAEEEF
Download sequence
Identical sequences 9823.ENSSSCP00000006195 ENSSSCP00000006195 ENSSSCP00000006195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]