SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006378 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006378
Domain Number 1 Region: 124-298,387-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.99e-42
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006378   Gene: ENSSSCG00000005970   Transcript: ENSSSCT00000006553
Sequence length 574
Comment pep:known chromosome:Sscrofa10.2:4:15248863:15279282:-1 gene:ENSSSCG00000005970 transcript:ENSSSCT00000006553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVSLANKELLLGVLVFLSLGLVLSYRCRYRNGALLGRQQSG
SQFAVFSDILSALPLIGFFWAKSPTGSEKKEQLGSRRGKKGSNISETTLVGAAASPLISS
QNDPEIIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRILGEYLQPGGCHVLKDLGL
EDTMEGIDAQVVDGYIIHDQESKSEVQIPFPLSENNHVQSGRAFRHGRFIMGLRKAAMAE
PNAKFIEGTVLQLLEEEDVVLGVQYRDKETGDIKELHAPLTIVADGLFSKFRKNLISNKV
SVSSHFVGFLMENAPQFKANHAELVLANPSPVLIYQISPSETRVLVDIRGEMPRNLREYM
IENIYPQLPDHLKEPFLEASQNSHLRSMPASFLPSSPVNKRGVLLLGDAHNMRHPLTGGG
MTVAFNDIKLWRKLLKGIPDLYDDAAILQAKKSFYWTRKMSHSFVVNVLAQALYELFSAT
DDSLYQLRKACFFYFKLGGECISGPVALISVLSPNPLVLIGHFFAVAVYATYFCFKSEPW
ITKPRAIFSSGAVLYRACSVLFPLIYSEIKYLVH
Download sequence
Identical sequences A7L861
9823.ENSSSCP00000006378 NP_001094496.1.46622 ENSSSCP00000006378 ENSSSCP00000006378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]