SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006428 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006428
Domain Number 1 Region: 892-942
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000299
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1219-1266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000459
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006428   Gene: ENSSSCG00000006018   Transcript: ENSSSCT00000006604
Sequence length 1284
Comment pep:novel chromosome:Sscrofa10.2:4:24703617:24892685:1 gene:ENSSSCG00000006018 transcript:ENSSSCT00000006604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKKNPPLRNIASEGEGQTLEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNNKEEQ
SLHVQDPSSSSKKDLKSSVLSEKAGFNYESPGKGGSLPSYPHDEVTDRNMLAFLSPAAGG
VCEPLKSPQRAEADDPQDMACTPAGDSLETKEDPKMSPKATEETGQAQSGQANCQGSSPV
SVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLI
KHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVLSGVLQDINSSRPV
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPN
KIKTSLPSSEGAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPL
DSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYSKQHGGTQSGSLNPELNDKLSRGSV
INQNDLAKSAEGEPMAKAEKGSSGAKKKDFASKGAEDNMVTSYNCQFCDFRYSKSHGPDV
IVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLL
HLSPGAAGSSRVKHQCHQCSFSTPDVDVLLFHYESAHDAQASDVKQEGNHLQGSDGQQAV
KESKEHSCTKCDFITQVEEEISRHYRFIHRCKKCINLSFQHTMSTSFIERLNTIMIQEET
VTFALWEQAHTVFPTLKSEPKQWIDLRIYKATSPNHKMGQVLPVLAIKQQKNENREGGQD
LITVRNKTDDLQKNAWKSTNFIKDSIFFLKTSLRKLIPVLFCQDYTKILKKSKNILIEVV
SRNPYYSMVLQTSGSWKRSRAPNRNNVVATQMPPKSQKKKKSDQSQVLLNRRRGSGVFCA
NCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEA
LQAEQLNKQQRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQGSLTKSHSAQ
QPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRPAKH
PNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNP
CQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPSNVKNEGPL
NVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYD
FTTHIQRGLHRNNAQAEKNGKPKE
Download sequence
Identical sequences ENSSSCP00000006428 ENSSSCP00000006428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]