SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006452 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006452
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-31
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 212-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006452   Gene: ENSSSCG00000006039   Transcript: ENSSSCT00000006628
Sequence length 859
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:35438363:35519614:1 gene:ENSSSCG00000006039 transcript:ENSSSCT00000006628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWSTKESPRWRSALFLLFLAGVYGNGALAEHSENVHISGVSTACGETPEQIRAPSGI
ITSPGWPSEYPAKINCSWFIRANPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIESYR
ACGSTIPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCVP
AAWKCNNMDECGDSSDEEICAKEANPPTSASFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSS
NIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENE
RRDSAGASGGVAAPLPQKVPPTTAVEATVGASGSSSAQSTRGGHTDAGRDVTNAEPPSVS
PARHQLTSALSRMTQGLRWVRFTLGRSSSVSQNQSPLRQLDNGVSGREEDDDVEMLIPVS
EGASDFDVSDCSRPLLDLASDQGQGFRQPYSATNPGVRPGSRDGPCERCGIVHTAQIPDT
CLEATLKNETSDDEALLLC
Download sequence
Identical sequences A0A286ZXB4
ENSSSCP00000006452 ENSSSCP00000006452 9823.ENSSSCP00000006452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]