SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006526 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006526
Domain Number 1 Region: 442-472,512-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000785
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006526   Gene: ENSSSCG00000006116   Transcript: ENSSSCT00000006708
Sequence length 538
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:49029945:49258394:-1 gene:ENSSSCG00000006116 transcript:ENSSSCT00000006708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVQQVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAV
ERLVPLSSRNLTTQSNTSVLGLSDFEMQRIGIAAAVSFLGGVIQVAMFVLQLGSATFLLT
EPVISAMTTGAATHVVTSQVKYLLGIKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSL
LSIVVLVLVKELNEQFKRKIKIVLPVDLVLIITASFTCYCTNMENIYGLEVVGHIPKGIP
PPKAPPMNVLSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNVIPS
FFFCIPSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYVIGPLLYWLPMCVLASIIVV
GLKGMLIQFRDLKKYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVVCTIAIVIGRFPRE
KTLSIKNMKETEFKVKTEMDDETLQQVKIISINNPLVFLNAKKFYTDLMNIIEKENASNQ
PLDEISKCEQNTLLNSLSNGNCNEEATQPCLNKCSLILDCSGLTFSDYSGVSMLVEVF
Download sequence
Identical sequences ENSSSCP00000006526 ENSSSCP00000006526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]