SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006564 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006564
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Lipocalins 6.03e-49
Family Fatty acid binding protein-like 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006564   Gene: ENSSSCG00000006153   Transcript: ENSSSCT00000006747
Sequence length 135
Comment pep:known chromosome:Sscrofa10.2:4:60306137:60311183:-1 gene:ENSSSCG00000006153 transcript:ENSSSCT00000006747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIQQLVGRWRLVESKGFDEYMKEVGVGMALRKMGAMAKPDCIITFDGKDLTIKTESTL
KTTQFSCNLGQKFEETTADGRKTQTVCDFTNGELVQHQEWDGKESTITRKVENGKLVVVC
VMNNVTCTRVYEKVE
Download sequence
Identical sequences Q2EN74
ENSSSCP00000006564 NP_001034835.1.46622 ENSSSCP00000006564 9823.ENSSSCP00000006564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]