SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006582 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006582
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 2.22e-51
Family PR-1-like 0.0001
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 9.81e-30
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 3 Region: 391-495
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-28
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006582   Gene: ENSSSCG00000006171   Transcript: ENSSSCT00000006765
Sequence length 500
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:66613220:66662220:-1 gene:ENSSSCG00000006171 transcript:ENSSSCT00000006765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCTAREWLRVTTLLFMARAVPAMVVPNATLLEKLLEKYMDEDGEWWMAKQRGKRAITDN
DMQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAETCLWEHGPASLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSSRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLC
YKEGSDSYYPPREEETNEIERQQSQVHATHIRTRADDSDRNEVISTQQMSQIVSCEVRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDGGWVDITRQGR
KHYFIKSNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR
NCMQANPHYARVIGTRIYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYTASFQNGI
FSESLQNPPGGKAFRVFAVM
Download sequence
Identical sequences F1RWK3
XP_001926638.1.46622 9823.ENSSSCP00000006582 ENSSSCP00000006582 ENSSSCP00000006582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]