SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006748 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006748
Domain Number 1 Region: 99-166
Classification Level Classification E-value
Superfamily Homeodomain-like 8.55e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 6-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000724
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006748
Domain Number - Region: 35-64
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0143
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006748   Gene: ENSSSCG00000006329   Transcript: ENSSSCT00000006937
Sequence length 295
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:93227597:93275883:1 gene:ENSSSCG00000006329 transcript:ENSSSCT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGD
YEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGAPEDGKDHKRPKRPRTILTTQQR
RAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNT
QRLNSAQTNGGGSVGMEGIMNPYTALPTPQQLLAIEQSVYNSDPFRQGLTPPQMPGDHMH
PYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
Download sequence
Identical sequences ENSSSCP00000006748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]