SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006773 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006773
Domain Number 1 Region: 106-347
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000000284
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-27
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006773   Gene: ENSSSCG00000006353   Transcript: ENSSSCT00000006962
Sequence length 348
Comment pep:known chromosome:Sscrofa10.2:4:97083417:97088469:1 gene:ENSSSCG00000006353 transcript:ENSSSCT00000006962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGEDEPRNCAVCGDRATGYHFHALTCEGCKGFFRRTVNKSTSLICPFAGSCKVNKAQR
RHCPACRLQKCLDAGMKKDMILSAEVLALRRARQVQRRAQQASLQLSKEQKALVQILLGA
HTRHMGTMFDQFVQFRPPAHLFIHHQHLPPLVPELSLLMHFADINTFMIQQIIKFTKDLP
LFRSLPMEDQISLLKGAAVEICQIVLNTTFCLQTQKFLCGPLRYTIEDGAHVGFQEEFLE
LLFGFHKTLRRLQLQEPEYVLMVAVALFSPDRPGVTQRKEIDQLQEEMALTLQSYIKGQQ
PSLRDRFLYAKLLGLLAELRSINKEYWYQIQNIQGLSTMMPLLQEICS
Download sequence
Identical sequences Q2V0W3
ENSSSCP00000006773 NP_001033085.1.46622 XP_013852276.1.46622 ENSSSCP00000006773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]