SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006886 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006886
Domain Number 1 Region: 678-906
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-58
Family DBL homology domain (DH-domain) 0.00000000117
Further Details:      
 
Domain Number 2 Region: 272-448
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-56
Family Regulator of G-protein signaling, RGS 0.0000000295
Further Details:      
 
Domain Number 3 Region: 909-1043
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-43
Family Pleckstrin-homology domain (PH domain) 0.000000279
Further Details:      
 
Domain Number 4 Region: 2-43
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000473
Family PDZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000006886
Domain Number - Region: 71-81
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006886   Gene: ENSSSCG00000006461   Transcript: ENSSSCT00000007078
Sequence length 1486
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:101505332:101731624:1 gene:ENSSSCG00000006461 transcript:ENSSSCT00000007078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSPSSVGVSGLQQDPAP
AGAPRVTPVVPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQILRNMLRQEEKELQRICE
VYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLYGDTSQRSSEGRLSLDSQE
GDSGLDSGTERFPSLSESLMNRNSILSDPGLDSPRTSPVIMARMAQHHRRQGSDAPLLPS
SDQGVDQSPKPLIIGPEEDYDPGYFNNESDIVFQDFEKLKSRPAHLGVFLRYIFSQADPG
PLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKVPEMLQAEIDLRLRSGEDVR
AVLCEAQEAAMPDIQEQIQDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALG
DILSKYEEDRSAPMDFALNTYMSHAGIRLRETRPSNAAEKAQSAPDKDKWLPFFPKTKKQ
SSNSKKEKDALEDKKRNPILKYIGKPKGSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQ
YDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDV
DMDAAAEAARLHQSASSSASSLSTRWSLENPTPPFTPKMGRRSIESPSLGFCTDALLPNL
LEDDLGHLSDLEPEPDAQNWQHTVGKDVVAGLSQREIDRQEVINELFVTEASHLRTLRVL
DLIFYQRMKKEGLLPREELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLAR
FDGPAREELQQVAAQFCSYQSIALELIKTRQRKESRFQLFMQEAESHPQCRRLQLRDLII
SEMQRLTKYPLLLENIIKHTVGGTTEHEKLCRARDQCREILKYVNEAVKQTENRHRLESY
QKRLDTTSLERASNPLAAEFKSLDLTARKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLL
QKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQI
YELVALTSSDKNTWMELLEEAVRNATRHPGAAPTPVHPPPPGPQEPAHQSPTPSRVELDD
SEVFRSGPEPEAVPGGPGPQQRIKGKHPALLEDPEQEGSREEEELGALPDPSTSPDREKR
GSRTRDPILRPLPGPLFMEGLADAALEDVENLRQLILWSLLPGHPMDPQAAGEPEDDLTP
TPSVISITSHPWDPGSPGRAPPGGEGDNAQLSGPERGQPGQEDVALRSLEHLPPRTRNSG
IWESPDLDRNPEEEASSTEATGSYKVVRKAEVAGSKVVPELPECGQSEPEPPEVEGGAEA
TGNCFYVSMPAGPPDSSTDSLGARRSPSQPDGLPAWQTEPRPPPRGGSGDQRHPGHSPPS
LALRDVGMIFRTIEQLTLKLSRLKDMELAHRELLRSLGGESSGGTTPVGSFHTEPTRWTD
SSLSPPAKEPPASDSRDSHEMGPCPEDGEWSPQEAGAADTATSPGL
Download sequence
Identical sequences ENSSSCP00000006886 ENSSSCP00000006886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]