SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007146 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007146
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 
Domain Number 2 Region: 315-489
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000505
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007146   Gene: ENSSSCG00000006702   Transcript: ENSSSCT00000007341
Sequence length 536
Comment pep:known chromosome:Sscrofa10.2:4:110166400:110202848:1 gene:ENSSSCG00000006702 transcript:ENSSSCT00000007341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGAGASGLTSIKCCLEEGLEPICFERTDDIGGLWRFQVEPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSKVLEYFKMYAKEFDLLKYIRFKTTVCSVKKQPDF
STSGQWEVVTEFEGEKEVNIFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKTP
ESFTGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGDYGYPIDVLLSSRF
YHFMKNICGQSISNISLERQLNKRFDHEMFGLKPKHSIHRALSQHPTVNDDLPNRIISGL
VKVKANVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDCVKVVKNKISLYKMVF
PPNLEKPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSKSEMIREIAKFQENMA
KRYVDSQRHTIQGDYIDTMEELADLVGVRPNLLSLAFSDPRLAFQLLWGPCTPIQYRLQG
PGKWDGARKAILTTEDRIRKPLVTRVTENNNSMTSTITVARFMLAVVFFAIILTYF
Download sequence
Identical sequences 9823.ENSSSCP00000007146 ENSSSCP00000007146 ENSSSCP00000007146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]