SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007286 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007286
Domain Number 1 Region: 85-232,270-358,393-579
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.54e-72
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007286   Gene: ENSSSCG00000006831   Transcript: ENSSSCT00000007482
Sequence length 645
Comment pep:known chromosome:Sscrofa10.2:4:121229989:121289559:1 gene:ENSSSCG00000006831 transcript:ENSSSCT00000007482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASFGQDRVDAPPPPAAPLSRWSGPVGVSWGLRAAAPGGPVPRGGRWRRSALDEDEDCGGV
RDFVARLANNTHQHVFDDLSGSVSLSWVGDSTGIILVLTTFHVPLVIMTFGQSKLYRSED
YGKNFKDITNLINNTFIRTEFGMAIGPENSGKVILTAEVSGGSHGGRIFRSSDFAKNFIQ
TNLPFHPLTQMMYSPQNSDHLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDSTIFF
TTYVNGSCKADLGALELRRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHV
STDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKS
LDRHLYTTTGGETDFTNVTSLRGVYMTSVLSEDNSIQTMITFDQGGRWKHLRKPENSECD
ATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMIPDVYISD
DGGYSWLKMLEGPHYYTILDSGGIIVAIEHSSHPINVIKFSTDEGQCWQTYVFSREPIYF
TGLASEPGARSMNISIWGFTESFLTRQWVSYTIDFKDILERNCEEKDYTVWLAHSTDPGD
YGDGCILGYKEQYLRLRKSSVCQNGRDYVVTKQPSVCPCSLEDFL
Download sequence
Identical sequences ENSSSCP00000007286 9823.ENSSSCP00000007286 ENSSSCP00000007286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]