SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007665 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007665
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.07e-17
Family Growth factor receptor domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007665
Domain Number - Region: 106-158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000484
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007665   Gene: ENSSSCG00000007197   Transcript: ENSSSCT00000007876
Sequence length 222
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:38849180:38855792:1 gene:ENSSSCG00000007197 transcript:ENSSSCT00000007876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCVICSEENGCSTCQQRLFLFIRREGIRQYGKCVHDCPPGYFGVRGQEVNRCKKCGATCE
SCFSQDFCIQCKRRFYLYKGKCLPTCPPGTTAQQSARECQANPIDECELGPWGSWSPCTH
NGKTCGSAWGLETRVREAGRAGREETAACQVLSESRKCPIRRPCPGDKREAAGVVGKMQT
VKTKPKKKKNKVGGQGVRRGAGVRQAWEGVGTQSLLPSFPPS
Download sequence
Identical sequences ENSSSCP00000007665 ENSSSCP00000007665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]