SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007787 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007787
Domain Number 1 Region: 102-166
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-25
Family SCAN domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007787   Gene: ENSSSCG00000007312   Transcript: ENSSSCT00000008001
Sequence length 179
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:44651004:44651543:-1 gene:ENSSSCG00000007312 transcript:ENSSSCT00000008001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATELSLAATGSLALPLGKEEGAGPSSGPERDSADSFSTPEAPPPAPKPSSPKAEVAEE
NPTPHSAASASLELPLGPAALGSASFAEAAPRSPPGPGGSRPGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRLRRRTDVRITG
Download sequence
Identical sequences F1S487
ENSSSCP00000007787 9823.ENSSSCP00000007787 XP_003134467.1.46622 ENSSSCP00000007787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]