SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007862 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007862
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number 2 Region: 187-231
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007862   Gene: ENSSSCG00000007379   Transcript: ENSSSCT00000008077
Sequence length 244
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:52668111:52683103:1 gene:ENSSSCG00000007379 transcript:ENSSSCT00000008077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTAQTLILAFSLLCLLSKVCAQLCPTPCACPWPPPRCPPGVPLVLDGCNCCRVCARRL
GEPCDHLHICDSSQGLVCQLGAGPGSRGAVCLWGEDDGSCEVNGRLYRDGETFQPHCRIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDPQPLPARGPQFSGLVA
PPVPGIPCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQRRLCLPGPCPPARGHSPR
NSAF
Download sequence
Identical sequences A0A287BT12
XP_003134500.1.46622 XP_003134501.1.46622 ENSSSCP00000007862 9823.ENSSSCP00000007862 ENSSSCP00000007862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]