SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007949 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007949
Domain Number 1 Region: 65-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007949
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000157
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007949   Gene: ENSSSCG00000007461   Transcript: ENSSSCT00000008165
Sequence length 252
Comment pep:novel chromosome:Sscrofa10.2:17:57320300:57338520:1 gene:ENSSSCG00000007461 transcript:ENSSSCT00000008165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VATVSWARGPWGTRWLGQGCAALGRCCPGRDPTCAARGPPRCFCDQACGTVRDCCPDYAR
ACPAVSCVVAEWSGWSRCVKPCQVSYRVRQRHVLQEPRNGGAPCPPLEERAGCVEYRNHQ
GVECQQSLLPALITTGSYGKEREKQGVPKKQEMAGYCVQFRLGPIPGSCQQARAPHAQWT
RYLTRGHTVCVRCEWPAQDARSRRCYGDGGGARGHQLLLWQAAGHPRCRGTWERLGQLRH
CSCPEVHRLVFI
Download sequence
Identical sequences 9823.ENSSSCP00000007949 ENSSSCP00000007949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]