SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007979 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007979
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000707
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 9.39e-18
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007979   Gene: ENSSSCG00000007488   Transcript: ENSSSCT00000008197
Sequence length 306
Comment pep:known chromosome:Sscrofa10.2:17:62396310:62548050:1 gene:ENSSSCG00000007488 transcript:ENSSSCT00000008197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVT
ELNNVKNVARLPKSTKKHAVGIYFNDDTSKTFACDSDLEADEWCKVLQMECVGTRINDIS
LGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEHICLWDVQNPRVKLISWP
LSALRRYGRDAAWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQS
VKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVTSPLKLHRTETFP
TYPSEH
Download sequence
Identical sequences A5GFP8
ENSSSCP00000007979 NP_001116579.1.46622 ENSSSCP00000007979 9823.ENSSSCP00000007979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]