SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008064 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008064
Domain Number 1 Region: 13-238
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.85e-16
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008064   Gene: ENSSSCG00000007551   Transcript: ENSSSCT00000008283
Sequence length 251
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:809111:809866:1 gene:ENSSSCG00000007551 transcript:ENSSSCT00000008283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLGPGASGWAVWDLGSEVRVTLLVLFNVSALVALYSTALLGLDCYIERALPRSYMSSVY
NTRHVCGFVWGGALLASFSSLLSYICSHVAARVAECSRMQDAQAADAILVLIGYLVPALA
ALYALVLIARVRKQATPLDQDAGGLDPAAHRLLVATVCTQFGLWTPHYLTLLGRTVLAAR
GKPVDGQHLGVLLLARDLSRLLAFCSSSTLPLLYRYINRSFPGKLQRLLKKMHRGHRSCS
LDQAGAPPVTA
Download sequence
Identical sequences ENSSSCP00000008064 ENSSSCP00000008064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]