SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008070 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008070
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-33
Family Calponin-homology domain, CH-domain 0.0000448
Further Details:      
 
Domain Number 2 Region: 183-212
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000046
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 213-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00002
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008070   Gene: ENSSSCG00000007557   Transcript: ENSSSCT00000008289
Sequence length 981
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:1066675:1085568:-1 gene:ENSSSCG00000007557 transcript:ENSSSCT00000008289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAITALQQWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFNALRKENIYE
NNQLAFRVAEEQLGIPALLDAEDMVALRVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKR
PPSDSSEEPSGKKAPSQPARPLPTPARGQPLSPVSTNPTVPRKEGGTEGPPRKAGPASAP
SSVSGTCGICGQHVHLVQRHLADGRLYHRSCFRCKQCSSTLHSGAYRATGEPGVFVCSSH
HPETASASPHGPTDSKLPGAPRKAQEAQEAHGQRDAGPKARPPAWEPRVGNVTARGFAPA
TADPPATTASSHAPMGSPAGPRFSAGLAPGKASTHVTNSSPTGWSLPPGSSRPATTPSAL
DPRPATPQGQVTPKVAAPQTKLSSRPASPAPAKAPASTSSTSRMQQARERFFQTPGAALD
QRPAGKVPAATEDAASRDSSKAQARSFLQKALPELREAGSQAPGRSGGPRSSPAGAGPRP
PRGRRSACSVGGPMCPTMVTPPVRRLPTRPADGAAPTVSCYPSYWGYFSSELSPCCWTSR
GAQGLPGGRCPVPALGPAVPAASRMSLRPSLAPAPALNSHPRTEGSGANPSAKLSRLASP
QAPNPAARTEPPAPLSVGSTMRASPQAGKKVSPAPSGAVKAGAGSRPKPEAPLAKGKSPL
TWEGQEDGPAGWRARLKPVEKKSPPESRSPSPSPTGQPVLGDPRTCSARGADGPGWACVS
CTHVALPLPWAAASPSPSPARRRKLAVPASLDVSGNWLQPEPSGREAPAWSWKQEDKPGR
PLGPAGVPAPPGKSVTSPGRLHPDYVPQEEIQRQVRDIERQLDVLELRGVELEKRLRAAE
GDVAEDALMVDWFRLIHEKQLLLRLESELMYKARDQRLEEQQQDLEGELRRLMAKPEGLK
SPQDRQREQDLLNQYVTTVNDRSDIVDFLDEDRLREQEEDQMLQSMIQKLDLQRSGGDQR
KKPKFRLSNIWSPKSRSRTPE
Download sequence
Identical sequences ENSSSCP00000008070 ENSSSCP00000008070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]