SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008164 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008164
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-39
Family SCAN domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000275
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008164   Gene: ENSSSCG00000007643   Transcript: ENSSSCT00000008383
Sequence length 563
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:7175429:7190926:1 gene:ENSSSCG00000007643 transcript:ENSSSCT00000008383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEEHMWGQDTSLQESPPPDPEIFRQRFR
HFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATPSHF
KHSSRKPRLSQPRALPATHVPAPPQEGSPRDQAMASSLLTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDSRQENYGNVISQGGENRTEKEESTSKAESAEDAASHGETAGKFQKD
FGEKREQQGRVAERQQRNAEEKTGKEKRDPGPAAAKEKKPSPGERGPREKGKGLGRSFSL
SSNFTTPEEAPTGAKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHT
RERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences 9823.ENSSSCP00000008164 ENSSSCP00000008164 ENSSSCP00000008164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]