SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008332 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008332
Domain Number 1 Region: 53-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-57
Family G proteins 0.0000000119
Further Details:      
 
Domain Number 2 Region: 349-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.96e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000222
Further Details:      
 
Domain Number 3 Region: 252-346
Classification Level Classification E-value
Superfamily Translation proteins 3.93e-28
Family Elongation factors 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008332   Gene: ENSSSCG00000007803   Transcript: ENSSSCT00000008551
Sequence length 452
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:18706410:18710027:-1 gene:ENSSSCG00000007803 transcript:ENSSSCT00000008551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATLLRATPLFSGLGAGPTSLLQGLLRPLKAPALPLLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTANR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPIIVGSALCALEQRDPELGLKSVQKLL
DAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQTHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRIILPQGKELAMPGEDLKLTLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTDTPAMTEEDKNIKWS
Download sequence
Identical sequences F1RFI1
XP_003124563.3.46622 ENSSSCP00000008332 9823.ENSSSCP00000008332 ENSSSCP00000008332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]