SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008351 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008351
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-34
Family SCAN domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 776-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.12e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008351
Domain Number - Region: 738-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000143
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 250-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0131
Family KRAB domain (Kruppel-associated box) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008351   Gene: ENSSSCG00000007823   Transcript: ENSSSCT00000008572
Sequence length 838
Comment pep:novel chromosome:Sscrofa10.2:3:21828112:21892439:1 gene:ENSSSCG00000007823 transcript:ENSSSCT00000008572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLDPQIHASLEAEGCLIMKVEKEPEWASEPILEGSDGSECETFRKCFRQFCYDDVTG
PHEAFSKLWELCCRWLKPEMRSKEQILELLVIEQFLTILPEKIQAWAQKQCPESGEEAVA
LVIHLEKENRRLRQQVSSPVHSEKQVPVGAAWEVADFEPEQVETQPRLMSQEEVERLHSG
HQEPLNQKRELRPLPKNAQPSPWVPAPADDWNTMAQEVTATQLPVGSQRPGKDIHMARGF
PYKKSVHQIPAHRDLCGDIRKESVGNMVSLGSTVTTSNKIPRVEQRKEPWTIGLHSSSKR
NILRSSYVKEKPVPALQVPARNAGKTWREQQQWGLEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAF
FEDMDALLNPTAHASSTDKPKEILSLPRLKRISISAKERINLVEEEDAAEESDGDEMGVE
FIRKSELHGAPVLFQNLSGVHWGYEETKTFLEILRETRFYEALQACHRKSKLYGAVAEQL
RECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRVPAPPAGTPEEV
PSPSFQEREDIEIEPQEPVGWEPEEASQEAVVEDSGSERMSEEEIVQEPEFLGPPGLLQS
PHDFEIGSSFNEDATQVIYKDLEQHRALIEKAKRVVSQNADPGKHHKRECISGRQWENLQ
GIRQGKPMAQPRDLGKAVVHQRPFLGKRPYRLLRYGEGFGRSARLLCRMPHQKENPYKCS
VCGKCFGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYSSVFP
Download sequence
Identical sequences ENSSSCP00000008351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]