SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008497 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008497
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-36
Family SCAN domain 0.00000596
Further Details:      
 
Domain Number 2 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 318-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008497   Gene: ENSSSCG00000007958   Transcript: ENSSSCT00000008721
Sequence length 412
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:40173817:40181077:-1 gene:ENSSSCG00000007958 transcript:ENSSSCT00000008721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKMEITLNSQCHIQASSKQERHIIGKLEEKREPAQQKDWPDPELSRQNFRRFCYQEAS
GPQEALSRLRQLCRQWLQPEVHTKEQILELLVVEQFLNILPPEIQARARRRCPVSSKEIV
TLVEDFHRAAKGPKQWVAVCMEGQKVLLEKTGSQLGEQELPDFQPQTPRRHPRESPLEET
SQEGSQDQRSPHPREKSPLLQEPAPKLAGTVIEAPRMKSDNKENPQQEGAKGAKPCTLSA
GRPKGNGLQSPEPRGATVSELRLSRRQVSPSNAPKPFAHYQRHCRELDFISSPLKSHPLR
ELKKSKGSRRSLSSRLQRLGHQPAHSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYT
CVECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Download sequence
Identical sequences ENSSSCP00000008497 ENSSSCP00000008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]