SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008503 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008503
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 4.47e-24
Family Pyrin domain, PYD 0.0028
Further Details:      
 
Domain Number 2 Region: 463-528
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-17
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008503
Domain Number - Region: 395-444
Classification Level Classification E-value
Superfamily RING/U-box 0.000813
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008503   Gene: ENSSSCG00000007964   Transcript: ENSSSCT00000008727
Sequence length 671
Comment pep:known chromosome:Sscrofa10.2:3:40322574:40334679:1 gene:ENSSSCG00000007964 transcript:ENSSSCT00000008727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLYSLEELVPYDFEKFKFKLQNTSLEKEHSRIPRGQLQTAQPVKLAMLLVTH
YGEDYAVQLTLQVLRAINQHLLAEELHRAISPEYQIQENDTDSSATSCSSREIKPKSLKI
LDGLEGDKQRQSSDGAGCPPSMQPEAGKGPQKKPQVKRRDQKGPEGLDAQSKPGARNMTT
SSKRSPLPSKPQGEKGSKPGVSLRRNASSAGRLQGLAGGSLAGSLGRREFKISEAYLPTG
KKRPKSLELTISPGEIESLHPETLLLQEKMGSENPGSAATPSEMATLNVCAPVAPEKGSR
NLEHSMTLQGGALRNTLSNISLAAKKKTWERPESTAPPEKKGTEAPESSRTVEEVAGGVL
HVPSNPKGPLSSGKKGPQNPGDSASLGIMTCAGWRLQNEAVCPLCRTQQADPVGGSCAHN
SCSFSVAPEASRGHSPSCLGCQDMFPGKSCGSHEQQVGLQMGSLSPKSLPQCERHKQQVQ
LLFCEDHGEPICLMCGLSPEHRGHRVRPIEEAALEYKEEIQKQLEHLKELRKSGEEERSQ
GHKKTVNFLKQAETQKQRVQYQLEQLCQFLEQQEQLFVTWLDEVGQTINHVRKTYGTQMT
RDVAVLDELIGELEAKQCQPEWELMKDIRVTLHRAKMVTDPELWTAPPEVKEKIHLLYQR
SEFVERSMKHF
Download sequence
Identical sequences ENSSSCP00000008503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]