SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008506 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008506
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.56e-37
Family SCAN domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 408-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 327-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 209-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000116
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008506   Gene: ENSSSCG00000007967   Transcript: ENSSSCT00000008730
Sequence length 472
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:40461244:40465155:-1 gene:ENSSSCG00000007967 transcript:ENSSSCT00000008730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPPEPQDQAPGEGEGLLIVKVEDSSWEQDSGQQEDSRDSEACRQRFRQFCYGDAGGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLSVLPVGIQDWVCEQHPGSGEEAVALV
ENLQKQPVKAWAQDVPSEEAEREAAVQGSRAKAPPQKAGAQSRPPLPWELHGRGAQQPAL
KEARPRETTDTRFSSGSPAPGSPEPGFLTSFQGPVTFGDIPFYFSREEWGSLDPSQRDLF
WDIKRENSRNVAPGLGFKSPSERPQLEEVVTAIPGQAVGDVAASWRPEAAEAWEREARPG
APRGRAAGARRGRPPTPRRQLRDLVAENPHSCGQCGKRFRWGSVLARHQRTHTGEKPHKC
QECDKSFRSSSDLVRHQGVHTGQKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCG
KSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Download sequence
Identical sequences ENSSSCP00000008506 ENSSSCP00000008506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]