SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008516 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008516
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Globin-like 3.39e-43
Family Globins 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008516   Gene: ENSSSCG00000007977   Transcript: ENSSSCT00000008740
Sequence length 141
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:40948175:40948852:1 gene:ENSSSCG00000007977 transcript:ENSSSCT00000008740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAQERVHIAQVWDLIAGHEAPFGAELLLRLFTAYPSTKTYFTHLGDSPDQARLLSHGR
RLLEAVGVAVQHVDNLRAALSPLADLHAHVLRVDPTNFPLLIQCFQVVLASHLQGEFTVE
MQAAWDKFLMGVAVVLTEKYR
Download sequence
Identical sequences F1RGX5
9823.ENSSSCP00000008516 XP_003481131.1.46622 ENSSSCP00000008516 ENSSSCP00000008516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]