SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008759 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008759
Domain Number 1 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-27
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008759   Gene: ENSSSCG00000008204   Transcript: ENSSSCT00000008985
Sequence length 120
Comment pep:known chromosome:Sscrofa10.2:3:59922284:59922947:1 gene:ENSSSCG00000008204 transcript:ENSSSCT00000008985 gene_biotype:IG_V_gene transcript_biotype:IG_V_gene
Sequence
MDFQAQILSILLLSVTVMIVSSGEIVLTQSAASKAVSQGENVIITCNGSPGVSTNKLHWY
QLKTGAPPRLLIYSKSSLAFWVPTRFSGSGSGTSYSCTISSVAAQDAADYYCQQSSSFPP
Download sequence
Identical sequences ENSSSCP00000008759 ENSSSCP00000008759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]