SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008968 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008968
Domain Number 1 Region: 179-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.81e-49
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 503-624
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.83e-31
Family Initiation factor IF2/eIF5b, domain 3 0.0011
Further Details:      
 
Domain Number 3 Region: 352-434
Classification Level Classification E-value
Superfamily Translation proteins 1.44e-22
Family Elongation factors 0.011
Further Details:      
 
Domain Number 4 Region: 619-718
Classification Level Classification E-value
Superfamily Translation proteins 7.07e-22
Family Elongation factors 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008968
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily F-box domain 0.024
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008968   Gene: ENSSSCG00000008404   Transcript: ENSSSCT00000009201
Sequence length 727
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:90740359:90772801:1 gene:ENSSSCG00000008404 transcript:ENSSSCT00000009201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKILKLENLLRFHTVCRQLHSLCQRRMLAQWRHVFSSAYPAWTAQLYAHSGQTDVLIR
AALSQQRLLATKKEERSQKSQLSSRKSKKEVEVWIGMTVEELARAMEKDIDFIYESLMNT
AVDIDSLEADSHLDEVWIKEVIKKSGMKLKWSKLKQDKVRENKDAVKRPQGDPALLIPRS
PVVAIMGHVDHGKTTLLDQLRKTQVAAMEVGGITQHIGAFLVSLPSGEKITFLDTPGHAA
FSAMRARGAQVTDIIILVVAADDGVMKQTVESIQHAKDAQVPIVLAINKCDKAEADPEKA
KKELLAYDVVCEDYGGDVQAVHVSALTGDNMMALTEATVALAEMLELKADPTGPVEGTVI
ESFTDKGRGPVTTAIIQRGTLKKGSILVAGKSWAKVRLMFDENGKTINEACPSMPVGIIG
WRDLPSAGDEILEVESEARAREVVDWRKYEQEQEKSKEDLKLIEEKRKEHQEAHQKAREK
YGTLSWKERSFIKYKEKKQQQPLKLKEKVERDSDVLPIIIKGDVDGSLEAILNIMDTYDA
SHECELELVHFGVGDISENDVNLAETFNGVIYGFNVNASNVIQQSAAKKGVKIKLHKIIY
RLIEDVQEELSSRLPCAVEEHIIGEASILATFSITEGKKKIPVAGCRVQKGQLEKQKKFK
LIRNGHVIWKGSLISLKHHKDDISVIKTGMDCGLSLDEEKIEFKVGDGIVCYEEKEVPAK
TSWDPGF
Download sequence
Identical sequences F1SQK6
ENSSSCP00000008968 XP_013851607.1.46622 XP_020943183.1.46622 XP_020943184.1.46622 9823.ENSSSCP00000008968 ENSSSCP00000008968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]