SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009366 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009366
Domain Number 1 Region: 845-984
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 5.1e-49
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000779
Further Details:      
 
Domain Number 2 Region: 583-833
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-33
Family Extended AAA-ATPase domain 0.00000582
Further Details:      
 
Domain Number 3 Region: 401-478
Classification Level Classification E-value
Superfamily BRCT domain 7.56e-18
Family DNA ligase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009366   Gene: ENSSSCG00000008788   Transcript: ENSSSCT00000009614
Sequence length 1146
Comment pep:known chromosome:Sscrofa10.2:8:32171423:32250851:-1 gene:ENSSSCG00000008788 transcript:ENSSSCT00000009614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIRKFFGVVPSGKKLVSETVKKNEKSKSAEETLKTKKGIKEIKVNSSCKDDDFQQKQPS
KKKRIIYDSDSESEETVQVKNTRKRPEKLPLSSKPAKIRHQDPVTYISETDEEDDFVCKK
AASKSKENGGSTNNYLGASNMKKNEENTKAKNKPLSPIKLTPTSVLDYFGTGSVQRSDKK
MVASRKKEPSQNADDSRLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKAKK
ALKDLEERETFSSLQASLCKAEKPKYPHKVKTERFSDERKNYSPKKQKCESSKESQPHSR
SSAHKIRETSSPKASSKLALLKRKEESSNNKTEPMGSKRKEDAIELKETRTPKKIKGSPA
KKESISPEDSEKRRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESIE
RDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSGKAAALGTKIIDEDGLLNLIRTM
PGKKSKYEIAVEAEMKKEKSKLERTPQKKDQGKRKVSPTKKESESKKCKQTPKRESSINS
IKKETSVFRKGLDFKEQVAEETDGDSRARNLADDSSENKVENLLWVDKYKPASLKTIIGQ
QGDQSCANKLLRWLQNWHKSPSEDKKRAAKFGKFAGKDDGSSFKAALLSGPPGVGKTTTA
SLVCQELGYSYVELNASDTRSKNSLKEIIAESLNNTSIKGFYSSGAAHSVSTKHALIMDE
VDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIK
GAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRAK
KDIKLGPFDVARKVFVTGEETAHMSLMDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDM
KKHLMLLSRAADSICDGDLVDRQIRNKQNWSLLPTQAIYASVLPGELMRGYMTQFPSFPS
WLGKHSSAGKHDRIVQDLALHMSLSLRTYSSKRTVNMDYLSHIRDALVQPLTSQGVEGVQ
DAVALMDTYYLMKEDFENIMEISSWGGRPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQA
VKTHRHSTGPVLDSEYNEELNEDDSQSDEKDQDTLESDAMIKKKPKPSKSEKDKESRKGK
GKSSKK
Download sequence
Identical sequences ENSSSCP00000009366 ENSSSCP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]