SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009388 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009388
Domain Number 1 Region: 8-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.77e-56
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 174-289
Classification Level Classification E-value
Superfamily Translation proteins 7.78e-24
Family Elongation factors 0.013
Further Details:      
 
Domain Number 3 Region: 415-509
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.45e-22
Family EF-G/eEF-2 domains III and V 0.016
Further Details:      
 
Domain Number 4 Region: 299-378
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-18
Family EF-G/eEF-2 domains III and V 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009388   Gene: ENSSSCG00000008807   Transcript: ENSSSCT00000009637
Sequence length 614
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:36876645:36897342:1 gene:ENSSSCG00000008807 transcript:ENSSSCT00000009637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKIDMSRFPVENTRNFSIIAHVDHGKSTLADRFLELTGAIDKTKNNKQVLDKLQVERERG
ITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQT
VANFFLAFEAQLSVIPVINKIDLKNADPERVEKQIEKVFDIPSDECIKISAKLGTNVESV
LQAVIKRIPPPKAHRKNSLRALVFDSTYDQYRGVIANVALFDGVVSKGDKIVSAHTQKTY
EVNEVGVLNPNEQPAYKLYAGQVGYLIAGMKDVTEAQIGDTLYLHKQPVEPLPGFKSAKP
MVFAGVYPIDQSEYNNLKNAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQ
RLEQEYNASVILTTPTVPYKAVLSSAKLIKEYREKEITIINPAQFPDKSKVTEYLEPIVL
GTIITPDEYTGKIIMLCQARRAVQKNMMYIDQTRVMLKYLFPLNEIVVDFYDSLKSLSSG
YASFDYEDAGYQTAELVKMDILLNGNIVEELVTVVHKDKAYSVGKTICERLKDSLPRQLF
EIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKKLRKIGNIEVP
KDAFIKVLKTQSDK
Download sequence
Identical sequences ENSSSCP00000009388 ENSSSCP00000009388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]