SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009394 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009394
Domain Number 1 Region: 850-1105
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-73
Family Eukaryotic proteases 0.0000701
Further Details:      
 
Domain Number 2 Region: 524-645
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.09e-35
Family Frizzled cysteine-rich domain 0.00012
Further Details:      
 
Domain Number 3 Region: 208-320
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.12e-31
Family Frizzled cysteine-rich domain 0.00073
Further Details:      
 
Domain Number 4 Region: 651-688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 413-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 340-377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 376-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 725-764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 450-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 691-723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 11 Region: 782-858
Classification Level Classification E-value
Superfamily SRCR-like 0.0000994
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009394   Gene: ENSSSCG00000008813   Transcript: ENSSSCT00000009643
Sequence length 1110
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:39505994:39782313:-1 gene:ENSSSCG00000008813 transcript:ENSSSCT00000009643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVSFSARVRSVRRPRSPCQGRCHIPCRGVLTVPLPPGALHASGGLGSAQAPVEAAERA
VGTSLSRVHGSAAPASPAPSIWKDGAASPAPDVLGADASNMGDGCSQKLATVNILRFLLL
VLIPCICALIVLLVILLSFVGTLKKAYFKSNGSEPLVTDGEVHVSGGILPNTVPNESTRV
SAVRPTPHIPAWTTDAAFPEDRNHRNTSACVNITHSQCQMLPYNTTLIPLFPLVKSMEIE
KFLKFFTYLHRLGCYQHILLFGCSLAFPKCVGDGDDSHGLLPCRSFCEAAKEGCESVLGM
VNASWPDFLKCSQFRNQSESSNISRICFSPQQEKEKQLLCGGGESFLCASGICVPRKLQC
NGYNDCDDWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTEEHR
CGDGRCIAVEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCVPSTFWCDGDEDCKDGS
DEESCSDGQTPCQEGDQRCLYSSCLDSCAGGSLCDPGNSPNNCSQCEPITLELCMNLPYN
YTNYPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDEITSQRIPPC
RALCEHSKDRCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDADVEECSPSHFKCSS
GRCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDNMDE
KNCSFCQDDELECANHECVSRDRWCDGEVDCVDSSDEWDCVTLSENVNSSSLLTAHRSAV
EHHVCADGWQETLSQLACKQMGLGEPSVTKLIQQQEQDQQWLTLHSGWERLNGTTLHKLL
VEGQSCHSRSKISLLCAKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICG
CVLIAKKWVLTVAHCFEGRENAAVWKVVFGINNLDHPSTFMQTRLVKSIILHPRYSRTVV
DYDISIVELSEDINETSYVRPVCLPSPEQSLEPDTYCYITGWGHMGNKMPFKLQEGEVRI
ISLEQCQSYFDMKTITTRMICAGYESGTVDSCMGDRGGPLVCERPGGQGALFGLTSWGCV
CFSKVLGRGYSKVTYFGGWIERQINIHACS
Download sequence
Identical sequences ENSSSCP00000009394 ENSSSCP00000009394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]