SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009479 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009479
Domain Number 1 Region: 161-238
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000102
Family Gar1-like SnoRNP 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009479   Gene: ENSSSCG00000008887   Transcript: ENSSSCT00000009730
Sequence length 461
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:55108280:55148770:-1 gene:ENSSSCG00000008887 transcript:ENSSSCT00000009730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVEAAAQLQTLKFGGVGVEAGEGLAVPALGPAALSAQHPDGGSLDRAEEQQLMRLPPA
GLQPPHRGSCPETSDSDSDSDSDTDSETDSSDSSSSSSSTSSSSSSSSGVSLPPVLSDGE
DDSQVEKENKNFPLKTKDELLLSELPSVEELTIILPEDIELKPLGMVSSVIEQLVIIESM
TNIPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSEHIESKGIKIKDTMYFAP
SMKDFTQYIFTEKLKQDRGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKF
RSEFNEPGEDFAEVHQNWNVHSSASEPSAGYCNREFTRGFSRGRHPRPCPGQPPLPQFYH
SGPMAPQETPGFPPQRQDSLVMPQYPFPPPVFDIHNFSLPPPPPPPPPPPVSANMGWATP
AVAPHQLLPLPYALPPPPPPPPLPPPSSSEDSNSSHFGPYY
Download sequence
Identical sequences F1RTX5
ENSSSCP00000009479 9823.ENSSSCP00000009479 ENSSSCP00000009479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]