SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009547 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009547
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.23e-33
Family Reprolysin-like 0.0039
Further Details:      
 
Domain Number 2 Region: 245-276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009547   Gene: ENSSSCG00000008946   Transcript: ENSSSCT00000009800
Sequence length 277
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:72658900:72666720:-1 gene:ENSSSCG00000008946 transcript:ENSSSCT00000009800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAFNVLFPQSISLIERGNPSRSLENVCRWACQQQKSDPNHSEHHDHAIFLTRQDFGPAG
MQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVM
APLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDEQCRFD
FGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHCMWKNA
NQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPM
Download sequence
Identical sequences ENSSSCP00000009547 ENSSSCP00000009547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]