SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009715 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009715
Domain Number 1 Region: 410-728
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.44e-105
Family PDEase 0.0000000000199
Further Details:      
 
Domain Number 2 Region: 14-208
Classification Level Classification E-value
Superfamily GAF domain-like 1.61e-44
Family GAF domain 0.0000744
Further Details:      
 
Domain Number 3 Region: 194-403
Classification Level Classification E-value
Superfamily GAF domain-like 1.83e-35
Family GAF domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009715   Gene: ENSSSCG00000009106   Transcript: ENSSSCT00000009973
Sequence length 741
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:111948592:112073066:1 gene:ENSSSCG00000009106 transcript:ENSSSCT00000009973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTPPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCED
SSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPRFNA
EVDQITGYRTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIV
LHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVD
EDCSVSTEKSSEISPCCKTQQEQSIKQKLERKDRDTNRINYMYAQYVKNTMEPLNIPDVS
KDKRFPWTNENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEETTGKVKPFNRND
EQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRKKKAAVVPSA
QTLKITDFSFSDFELSDVETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVA
YHNWRHAFNTAQCMFAALKAGKIQQRRLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIK
RRGEFFELIRKNQFNLEDPHQKELFFRAMLMTACDLSAITKPWPVQQRIAELVATEFFDQ
GDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKN
RQKWQALAEQQEKMLINGESS
Download sequence
Identical sequences ENSSSCP00000009715 ENSSSCP00000009715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]