SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009743 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009743
Domain Number 1 Region: 24-99
Classification Level Classification E-value
Superfamily Translation proteins 5.65e-18
Family Gar1-like SnoRNP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009743   Gene: ENSSSCG00000009137   Transcript: ENSSSCT00000010005
Sequence length 167
Comment pep:novel scaffold:Sscrofa10.2:GL893682.2:13238:22208:-1 gene:ENSSSCG00000009137 transcript:ENSSSCT00000010005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGGGRGGFNKGQDQGPPEREILILGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKE
QIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPP
RGGGRGGRGGGRGGGGRGGRGGGFRGGRGGGGFRGGRGGGGFRGRGH
Download sequence
Identical sequences ENSSSCP00000009743 ENSSSCP00000009743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]