SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009857 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009857
Domain Number 1 Region: 9-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000827
Family THAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009857   Gene: ENSSSCG00000009243   Transcript: ENSSSCT00000010123
Sequence length 510
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:144699084:144708830:-1 gene:ENSSSCG00000009243 transcript:ENSSSCT00000010123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRSKKIWIPGPGAMLCSKHFQESDFESYGIRRKLKKGAVPSVSLYKVLQGAHLKGKAR
QKILKQPLPDNSQEVATEDHNYSLKGPLTIGAEKLAEVQQMLQVSRKRLASAKNYRMIKK
RKGLRLIDALVEEKLLSEETEYLLRAQFSADFKWELYNWRETAGYSTEMKQFACTLYLCS
SKVYDYVRKILKLPHSSILRTWLSRCKPGPGFHSNVFSFLQQKVENGDQLYQYCSLIIKG
ISLKQQLQWDPSSHQLQGFMDFGLGKLDADEMPLASETVVLMAVGISGHWRTPLGYFFVN
RASGYLQAQLLRLTIGKLSDIGVTVLAVTSDATADSVQMAKSLGIRMDGDNMKCTFQHPS
SSGQQVAYFFDPCHLLRLVRNAFQNFQSIQFINGTAHWQHLVELVTFQEQELSNIERIPR
KLASLKHHILKTNGAAQLFSESMASALECLRSLGLPPFQNCVGTIHFLRLINNLFDIFNS
RNYYGKGLKGPLVPKTFNKINHVLIEAKTI
Download sequence
Identical sequences ENSSSCP00000009857 ENSSSCP00000009857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]