SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009988 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009988
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-29
Family Ribonuclease PH domain 1-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009988   Gene: ENSSSCG00000009358   Transcript: ENSSSCT00000010255
Sequence length 113
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:12778571:12784006:-1 gene:ENSSSCG00000009358 transcript:ENSSSCT00000010255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSSLVKLGNTTVIC
GIKAEFGAPPTDAPDKGYIVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVI
Download sequence
Identical sequences ENSSSCP00000009988 ENSSSCP00000009988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]