SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010222 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010222
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily BRCT domain 2.33e-17
Family DNA topoisomerase II binding protein 1, TopBP1 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010222   Gene: ENSSSCG00000009574   Transcript: ENSSSCT00000010495
Sequence length 133
Comment pep:novel chromosome:Sscrofa10.2:11:87137861:87140296:1 gene:ENSSSCG00000009574 transcript:ENSSSCT00000010495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVGIFEDCTFCLKVKHLPRQQKRKLQTDIKENGGNFSFLLNAQCTHVILDNADVLSQYQ
LNSLQKHHIHITNPEFIWESIKEGKLVDVRNYDPLKSVGIAPPPCQKASSSGKYFFSFLP
PFLPFVLSLFSFF
Download sequence
Identical sequences ENSSSCP00000010222 ENSSSCP00000010222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]