SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010275 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010275
Domain Number 1 Region: 10-83
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-20
Family PDZ domain 0.000089
Further Details:      
 
Domain Number 2 Region: 319-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000376
Family LIM domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010275   Gene: ENSSSCG00000009625   Transcript: ENSSSCT00000010551
Sequence length 359
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:7316099:7328155:1 gene:ENSSSCG00000009625 transcript:ENSSSCT00000010551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVVGPAPWGFRISGGRDFHMPITVTKVTERGKAEAADLRPGDIIVAINGESAKGM
LHAEAQSKIRQSPSPLRLQLDRSRAASPGQTNGESSMEVLATRFQGSRRGHTDSQSSLRS
SCSSQASLSPRPSSPFSTLPPTSPHTPAGEVVTSHSLQSLAHSPGPATADHLSYGGRPGS
RQTALDRQAGDWAVLVLPPQPSPGPRSSSPRLSVASEGESHLLREDSEVFKMLQENREAR
VAPRQSSSFRLLQEALEAEERGGTPAFLPSPLSPQSSLPTSRVLATPPKLHTCEKCSTSI
ANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPSTLNSQA
Download sequence
Identical sequences ENSSSCP00000010275 9823.ENSSSCP00000010275 ENSSSCP00000010275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]