SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010286 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010286
Domain Number 1 Region: 27-118
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000171
Family DEATH domain, DD 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010286   Gene: ENSSSCG00000021438   Transcript: ENSSSCT00000010562
Sequence length 130
Comment pep:novel chromosome:Sscrofa10.2:14:8180389:8181825:1 gene:ENSSSCG00000021438 transcript:ENSSSCT00000010562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEPAAAEGSRVRRGPLVPADGEDPTECLRQFFDDFSTIVPYDCWDKLMRKMGLTQNEIL
QSRDRARSTGDALYEMLETCVRRRGREASVNDLLDALEALGRYAKEKIEDTLVGSGKFIF
KESEAGAAVS
Download sequence
Identical sequences ENSSSCP00000010286 ENSSSCP00000010286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]