SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010696 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010696
Domain Number 1 Region: 287-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-70
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 18-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000549
Family LIM domain 0.00055
Further Details:      
 
Domain Number 3 Region: 125-218
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000128
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 75-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000228
Family LIM domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010696   Gene: ENSSSCG00000010025   Transcript: ENSSSCT00000010982
Sequence length 617
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:51124239:51149278:1 gene:ENSSSCG00000010025 transcript:ENSSSCT00000010982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYLSVPAYFTSRDPFRCSECQDSLTNWYYEKDGKLYCHKDYWGKFGEFCHGCSLLMTG
PAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTES
VQDQLPYSVTHISLPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPG
DRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLDARLSPHMQNAG
HSHTLSPLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLLSRDISRSESLRCSSSC
SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMR
SLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDPFPWQQKVRFAKGIASGMAY
LHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKKPSVEKAATKKRTLRKSDRK
KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVK
LFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEE
LDHTVSLQYGLIRDSPP
Download sequence
Identical sequences ENSSSCP00000010696 ENSSSCP00000010696 XP_001926100.1.46622 9823.ENSSSCP00000010696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]