SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010737 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010737
Domain Number 1 Region: 82-199
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.18e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010737   Gene: ENSSSCG00000010064   Transcript: ENSSSCT00000011025
Sequence length 240
Comment pep:novel chromosome:Sscrofa10.2:14:53243675:53249920:-1 gene:ENSSSCG00000010064 transcript:ENSSSCT00000011025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLELYLDLLSQPCRAIYIFAKKNGIPFELRTVDLRKGQHLSGAFAQVNPLQKVPVLKDG
DFILTESVAILLYLTRKYKVPDHWYPQDLQACAQVDEYLAWQHTTLRRNCLRALWHKVML
PVFMGELVSPETLGTTLAELDVTLQVLEDKFLQSKAFLAGPHISLADLVAITELMHPVGA
GCQVFEGRPKLAAWRQRVEVAIGEVLFQEAHEVILKAKDSQPVDPTLKQKLLPKVLAMIQ
Download sequence
Identical sequences F1RL37
9823.ENSSSCP00000010737 ENSSSCP00000010737 NP_001302497.1.46622 ENSSSCP00000010737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]