SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010769 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010769
Domain Number 1 Region: 187-501
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0087
Further Details:      
 
Domain Number 2 Region: 70-167
Classification Level Classification E-value
Superfamily ISP domain 1.44e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 505-583
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.34e-20
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010769   Gene: ENSSSCG00000010096   Transcript: ENSSSCT00000011057
Sequence length 604
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:54011361:54025450:1 gene:ENSSSCG00000010096 transcript:ENSSSCT00000011057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKDRKEELSASGKGSPRAYQGNGTARHFHAEERLPAPHPY
PGAQDFMEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVL
SRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVM
ATCISPSAGHSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKS
LDTQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSP
KTLSCKGKEVENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVV
ELEETPFRRLLGERVGRALMKMFENNRVKFYMQTEVLELRAQEGKLKEVVLKSSKVVRAD
VCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKV
NIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVVIQGDLH
ELKFVAFYTKGDEVISVASMNYDPIVSKVAEVLASGRSIRKREVELFLLHSKTGDMSWLT
GKGS
Download sequence
Identical sequences ENSSSCP00000010769 ENSSSCP00000010769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]