SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010771 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010771
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010771   Gene: ENSSSCG00000010098   Transcript: ENSSSCT00000011059
Sequence length 313
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:54040271:54042124:-1 gene:ENSSSCG00000010098 transcript:ENSSSCT00000011059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTAKTKGHSYPPGPPDVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPAALSASPTGRLEPGLSSPFSDLLG
PLGAQADEAGCSTQPSPEREPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGS
ALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEH
VHDFAMQLSSSMA
Download sequence
Identical sequences A0A287A5N0
ENSSSCP00000010771 ENSSSCP00000010771 9823.ENSSSCP00000010771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]